Anti CENPV pAb (ATL-HPA042616 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA042616-100

• 

Protein Description: centromere protein V
Gene Name: CENPV
Alternative Gene Name: CENP-V, p30, PRR6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018509: 95%, ENSRNOG00000003086: 71%
Entrez Gene ID: 201161
Uniprot ID: Q7Z7K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLDLGEQRERWETFQKRQKLTSEGAAKLLLDTFEYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKKQN
• Gene Sequence: NLDLGEQRERWETFQKRQKLTSEGAAKLLLDTFEYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKKQN
• Gene ID - Mouse: ENSMUSG00000018509
• Gene ID - Rat: ENSRNOG00000003086
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CENPV pAb (ATL-HPA042616 w/enhanced validation) – 1 Found

Nabi, Dalileh; Drechsler, Hauke; Pschirer, Johannes; Korn, Franz; Schuler, Nadine; Diez, Stefan; Jessberger, Rolf; Chacón, Mariola. CENP-V is required for proper chromosome segregation through interaction with spindle microtubules in mouse oocytes. Nature Communications. 2021;12(1):6547.