Anti CENPU pAb (ATL-HPA022048)

Atlas Antibodies

Catalog No.:
ATL-HPA022048-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: centromere protein U
Gene Name: CENPU
Alternative Gene Name: CENP-50, CENP-U, KLIP1, MLF1IP, PBIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031629: 53%, ENSRNOG00000022261: 53%
Entrez Gene ID: 79682
Uniprot ID: Q71F23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EETYETFDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPGRKLRPISDDSESIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAESV
Gene Sequence EETYETFDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPGRKLRPISDDSESIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAESV
Gene ID - Mouse ENSMUSG00000031629
Gene ID - Rat ENSRNOG00000022261
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CENPU pAb (ATL-HPA022048)
Datasheet Anti CENPU pAb (ATL-HPA022048) Datasheet (External Link)
Vendor Page Anti CENPU pAb (ATL-HPA022048) at Atlas Antibodies

Documents & Links for Anti CENPU pAb (ATL-HPA022048)
Datasheet Anti CENPU pAb (ATL-HPA022048) Datasheet (External Link)
Vendor Page Anti CENPU pAb (ATL-HPA022048)
Citations for Anti CENPU pAb (ATL-HPA022048) – 2 Found
Yang, Fan; Wang, Ying-Hao; Dong, Si-Yang; Chen, Cheng-Ze; Huang, Du-Ping. MLF1IP promotes cells proliferation and apoptosis by regulating CyclinD1 in breast cancer. International Journal Of Clinical And Experimental Pathology. 10(12):11554-11562.  PubMed
Sedzro, Divine Mensah; Yuan, Xiao; Mullen, McKay; Ejaz, Umer; Yang, Tongtong; Liu, Xu; Song, Xiaoyu; Tang, Yun-Chi; Pan, Weijun; Zou, Peng; Gao, Xinjiao; Wang, Dongmei; Wang, Zhikai; Dou, Zhen; Liu, Xing; Yao, Xuebiao. Phosphorylation of CENP-R by Aurora B regulates kinetochore-microtubule attachment for accurate chromosome segregation. Journal Of Molecular Cell Biology. 2022;14(7)  PubMed