Anti CENPQ pAb (ATL-HPA054965)

Atlas Antibodies

Catalog No.:
ATL-HPA054965-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: centromere protein Q
Gene Name: CENPQ
Alternative Gene Name: C6orf139, CENP-Q, FLJ10545
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023919: 68%, ENSRNOG00000056226: 58%
Entrez Gene ID: 55166
Uniprot ID: Q7L2Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VIMTILSNSIKEKEEIQYHLNFLKKRLLQQCETLKVPPKKMEDLTNVSSLLNMERARDKANEEGLALLQEEI
Gene Sequence VIMTILSNSIKEKEEIQYHLNFLKKRLLQQCETLKVPPKKMEDLTNVSSLLNMERARDKANEEGLALLQEEI
Gene ID - Mouse ENSMUSG00000023919
Gene ID - Rat ENSRNOG00000056226
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CENPQ pAb (ATL-HPA054965)
Datasheet Anti CENPQ pAb (ATL-HPA054965) Datasheet (External Link)
Vendor Page Anti CENPQ pAb (ATL-HPA054965) at Atlas Antibodies

Documents & Links for Anti CENPQ pAb (ATL-HPA054965)
Datasheet Anti CENPQ pAb (ATL-HPA054965) Datasheet (External Link)
Vendor Page Anti CENPQ pAb (ATL-HPA054965)