Anti CENPQ pAb (ATL-HPA054965)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054965-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CENPQ
Alternative Gene Name: C6orf139, CENP-Q, FLJ10545
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023919: 68%, ENSRNOG00000056226: 58%
Entrez Gene ID: 55166
Uniprot ID: Q7L2Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VIMTILSNSIKEKEEIQYHLNFLKKRLLQQCETLKVPPKKMEDLTNVSSLLNMERARDKANEEGLALLQEEI |
Gene Sequence | VIMTILSNSIKEKEEIQYHLNFLKKRLLQQCETLKVPPKKMEDLTNVSSLLNMERARDKANEEGLALLQEEI |
Gene ID - Mouse | ENSMUSG00000023919 |
Gene ID - Rat | ENSRNOG00000056226 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CENPQ pAb (ATL-HPA054965) | |
Datasheet | Anti CENPQ pAb (ATL-HPA054965) Datasheet (External Link) |
Vendor Page | Anti CENPQ pAb (ATL-HPA054965) at Atlas Antibodies |
Documents & Links for Anti CENPQ pAb (ATL-HPA054965) | |
Datasheet | Anti CENPQ pAb (ATL-HPA054965) Datasheet (External Link) |
Vendor Page | Anti CENPQ pAb (ATL-HPA054965) |