Anti CENPQ pAb (ATL-HPA054965)

Atlas Antibodies

Catalog No.: ATL-HPA054965-25

Protein Description: centromere protein Q
Gene Name: CENPQ
Alternative Gene Name: C6orf139, CENP-Q, FLJ10545
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023919: 68%, ENSRNOG00000056226: 58%
Entrez Gene ID: 55166
Uniprot ID: Q7L2Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VIMTILSNSIKEKEEIQYHLNFLKKRLLQQCETLKVPPKKMEDLTNVSSLLNMERARDKANEEGLALLQEEI
• Gene Sequence: VIMTILSNSIKEKEEIQYHLNFLKKRLLQQCETLKVPPKKMEDLTNVSSLLNMERARDKANEEGLALLQEEI
• Gene ID - Mouse: ENSMUSG00000023919
• Gene ID - Rat: ENSRNOG00000056226
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.