Anti CENPQ pAb (ATL-HPA046634)

Atlas Antibodies

SKU:
ATL-HPA046634-25
  • Immunohistochemical staining of human cerebellum shows moderate nucleolar positivity in Purkinje cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: centromere protein Q
Gene Name: CENPQ
Alternative Gene Name: C6orf139, CENP-Q, FLJ10545
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023919: 52%, ENSRNOG00000056226: 50%
Entrez Gene ID: 55166
Uniprot ID: Q7L2Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGKANASKKNAQQLKRNPKRKKDNEEVVLSENKVRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHLQTMME
Gene Sequence SGKANASKKNAQQLKRNPKRKKDNEEVVLSENKVRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHLQTMME
Gene ID - Mouse ENSMUSG00000023919
Gene ID - Rat ENSRNOG00000056226
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CENPQ pAb (ATL-HPA046634)
Datasheet Anti CENPQ pAb (ATL-HPA046634) Datasheet (External Link)
Vendor Page Anti CENPQ pAb (ATL-HPA046634) at Atlas Antibodies

Documents & Links for Anti CENPQ pAb (ATL-HPA046634)
Datasheet Anti CENPQ pAb (ATL-HPA046634) Datasheet (External Link)
Vendor Page Anti CENPQ pAb (ATL-HPA046634)