Anti CENPP pAb (ATL-HPA058945)

Atlas Antibodies

SKU:
ATL-HPA058945-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: centromere protein P
Gene Name: CENPP
Alternative Gene Name: CENP-P, RP11-19J3.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021391: 76%, ENSRNOG00000062220: 77%
Entrez Gene ID: 401541
Uniprot ID: Q6IPU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KHLKEKYPDAVYLSEGPSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLTKVPQRALELD
Gene Sequence KHLKEKYPDAVYLSEGPSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLTKVPQRALELD
Gene ID - Mouse ENSMUSG00000021391
Gene ID - Rat ENSRNOG00000062220
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CENPP pAb (ATL-HPA058945)
Datasheet Anti CENPP pAb (ATL-HPA058945) Datasheet (External Link)
Vendor Page Anti CENPP pAb (ATL-HPA058945) at Atlas Antibodies

Documents & Links for Anti CENPP pAb (ATL-HPA058945)
Datasheet Anti CENPP pAb (ATL-HPA058945) Datasheet (External Link)
Vendor Page Anti CENPP pAb (ATL-HPA058945)