Anti CENPM pAb (ATL-HPA056500)

Atlas Antibodies

SKU: ATL-HPA056500-25

• 

Protein Description: centromere protein M
Gene Name: CENPM
Alternative Gene Name: C22orf18, CENP-M, MGC861, Pane1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068101: 75%, ENSRNOG00000023262: 79%
Entrez Gene ID: 79019
Uniprot ID: Q9NSP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEG
• Gene Sequence: TEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEG
• Gene ID - Mouse: ENSMUSG00000068101
• Gene ID - Rat: ENSRNOG00000023262
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.