Anti CENPE pAb (ATL-HPA042294)

Atlas Antibodies

SKU: ATL-HPA042294-25

• 
• 

Protein Description: centromere protein E, 312kDa
Gene Name: CENPE
Alternative Gene Name: KIF10, PPP1R61
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045328: 56%, ENSRNOG00000009339: 60%
Entrez Gene ID: 1062
Uniprot ID: Q02224
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDN
• Gene Sequence: EKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDN
• Gene ID - Mouse: ENSMUSG00000045328
• Gene ID - Rat: ENSRNOG00000009339
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CENPE pAb (ATL-HPA042294) – 1 Found

Würtemberger, Julia; Tchessalova, Daria; Regina, Carla; Bauer, Christoph; Schneider, Michaela; Wagers, Amy J; Hettmer, Simone. Growth inhibition associated with disruption of the actin cytoskeleton by Latrunculin A in rhabdomyosarcoma cells. Plos One. 15(9):e0238572.