Anti CENPE pAb (ATL-HPA042294)

Atlas Antibodies

Catalog No.:
ATL-HPA042294-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: centromere protein E, 312kDa
Gene Name: CENPE
Alternative Gene Name: KIF10, PPP1R61
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045328: 56%, ENSRNOG00000009339: 60%
Entrez Gene ID: 1062
Uniprot ID: Q02224
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDN
Gene Sequence EKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDN
Gene ID - Mouse ENSMUSG00000045328
Gene ID - Rat ENSRNOG00000009339
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CENPE pAb (ATL-HPA042294)
Datasheet Anti CENPE pAb (ATL-HPA042294) Datasheet (External Link)
Vendor Page Anti CENPE pAb (ATL-HPA042294) at Atlas Antibodies

Documents & Links for Anti CENPE pAb (ATL-HPA042294)
Datasheet Anti CENPE pAb (ATL-HPA042294) Datasheet (External Link)
Vendor Page Anti CENPE pAb (ATL-HPA042294)
Citations for Anti CENPE pAb (ATL-HPA042294) – 1 Found
Würtemberger, Julia; Tchessalova, Daria; Regina, Carla; Bauer, Christoph; Schneider, Michaela; Wagers, Amy J; Hettmer, Simone. Growth inhibition associated with disruption of the actin cytoskeleton by Latrunculin A in rhabdomyosarcoma cells. Plos One. 15(9):e0238572.  PubMed