Anti CENPC pAb (ATL-HPA058252)

Atlas Antibodies

SKU:
ATL-HPA058252-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies, cytokinetic bridge, midbody, midbody ring & cleavage furrow.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: centromere protein C
Gene Name: CENPC
Alternative Gene Name: CENP-C, CENPC1, hcp-4, MIF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029253: 48%, ENSRNOG00000021776: 53%
Entrez Gene ID: 1060
Uniprot ID: Q03188
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSGKNDVDDEEVHGSSDDSKQSKVIPKNRIHHKLVLPSNTPNVRRTKRTRLKPLEYWRGERIDYQGRPSGGFVISGVLSPDTISSKRK
Gene Sequence MSGKNDVDDEEVHGSSDDSKQSKVIPKNRIHHKLVLPSNTPNVRRTKRTRLKPLEYWRGERIDYQGRPSGGFVISGVLSPDTISSKRK
Gene ID - Mouse ENSMUSG00000029253
Gene ID - Rat ENSRNOG00000021776
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CENPC pAb (ATL-HPA058252)
Datasheet Anti CENPC pAb (ATL-HPA058252) Datasheet (External Link)
Vendor Page Anti CENPC pAb (ATL-HPA058252) at Atlas Antibodies

Documents & Links for Anti CENPC pAb (ATL-HPA058252)
Datasheet Anti CENPC pAb (ATL-HPA058252) Datasheet (External Link)
Vendor Page Anti CENPC pAb (ATL-HPA058252)