Anti CENPBD1 pAb (ATL-HPA060522)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060522-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CENPBD1
Alternative Gene Name: MGC16385
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031285: 31%, ENSRNOG00000047712: 31%
Entrez Gene ID: 92806
Uniprot ID: B2RD01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ERPTDATVIPSAKRERKAITLDLKLEVLRRFEAGEKLSQIAKALDLAISTV |
| Gene Sequence | ERPTDATVIPSAKRERKAITLDLKLEVLRRFEAGEKLSQIAKALDLAISTV |
| Gene ID - Mouse | ENSMUSG00000031285 |
| Gene ID - Rat | ENSRNOG00000047712 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CENPBD1 pAb (ATL-HPA060522) | |
| Datasheet | Anti CENPBD1 pAb (ATL-HPA060522) Datasheet (External Link) |
| Vendor Page | Anti CENPBD1 pAb (ATL-HPA060522) at Atlas Antibodies |
| Documents & Links for Anti CENPBD1 pAb (ATL-HPA060522) | |
| Datasheet | Anti CENPBD1 pAb (ATL-HPA060522) Datasheet (External Link) |
| Vendor Page | Anti CENPBD1 pAb (ATL-HPA060522) |