Anti CENPBD1 pAb (ATL-HPA060522)

Atlas Antibodies

SKU:
ATL-HPA060522-25
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoli & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CENPB DNA-binding domains containing 1
Gene Name: CENPBD1
Alternative Gene Name: MGC16385
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031285: 31%, ENSRNOG00000047712: 31%
Entrez Gene ID: 92806
Uniprot ID: B2RD01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERPTDATVIPSAKRERKAITLDLKLEVLRRFEAGEKLSQIAKALDLAISTV
Gene Sequence ERPTDATVIPSAKRERKAITLDLKLEVLRRFEAGEKLSQIAKALDLAISTV
Gene ID - Mouse ENSMUSG00000031285
Gene ID - Rat ENSRNOG00000047712
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CENPBD1 pAb (ATL-HPA060522)
Datasheet Anti CENPBD1 pAb (ATL-HPA060522) Datasheet (External Link)
Vendor Page Anti CENPBD1 pAb (ATL-HPA060522) at Atlas Antibodies

Documents & Links for Anti CENPBD1 pAb (ATL-HPA060522)
Datasheet Anti CENPBD1 pAb (ATL-HPA060522) Datasheet (External Link)
Vendor Page Anti CENPBD1 pAb (ATL-HPA060522)