Anti CENPBD1 pAb (ATL-HPA060522)

Atlas Antibodies

Catalog No.: ATL-HPA060522-25

Protein Description: CENPB DNA-binding domains containing 1
Gene Name: CENPBD1
Alternative Gene Name: MGC16385
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031285: 31%, ENSRNOG00000047712: 31%
Entrez Gene ID: 92806
Uniprot ID: B2RD01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERPTDATVIPSAKRERKAITLDLKLEVLRRFEAGEKLSQIAKALDLAISTV
• Gene Sequence: ERPTDATVIPSAKRERKAITLDLKLEVLRRFEAGEKLSQIAKALDLAISTV
• Gene ID - Mouse: ENSMUSG00000031285
• Gene ID - Rat: ENSRNOG00000047712
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.