Anti CENPB pAb (ATL-HPA053507)

Atlas Antibodies

Catalog No.:
ATL-HPA053507-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: centromere protein B, 80kDa
Gene Name: CENPB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068267: 95%, ENSRNOG00000057284: 95%
Entrez Gene ID: 1059
Uniprot ID: P07199
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERGVVQQVKGHYRQAMLLKAMAALEGQDPSGLQLGLTEALHFVAAAWQAVEPSDIAACFREAGFGGGPNATITTSL
Gene Sequence ERGVVQQVKGHYRQAMLLKAMAALEGQDPSGLQLGLTEALHFVAAAWQAVEPSDIAACFREAGFGGGPNATITTSL
Gene ID - Mouse ENSMUSG00000068267
Gene ID - Rat ENSRNOG00000057284
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CENPB pAb (ATL-HPA053507)
Datasheet Anti CENPB pAb (ATL-HPA053507) Datasheet (External Link)
Vendor Page Anti CENPB pAb (ATL-HPA053507) at Atlas Antibodies

Documents & Links for Anti CENPB pAb (ATL-HPA053507)
Datasheet Anti CENPB pAb (ATL-HPA053507) Datasheet (External Link)
Vendor Page Anti CENPB pAb (ATL-HPA053507)