Anti CEMP1 pAb (ATL-HPA075926)

Atlas Antibodies

Catalog No.:
ATL-HPA075926-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cementum protein 1
Gene Name: CEMP1
Alternative Gene Name: CP-23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031789: 26%, ENSRNOG00000015493: 30%
Entrez Gene ID: 752014
Uniprot ID: Q6PRD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPP
Gene Sequence CPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPP
Gene ID - Mouse ENSMUSG00000031789
Gene ID - Rat ENSRNOG00000015493
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEMP1 pAb (ATL-HPA075926)
Datasheet Anti CEMP1 pAb (ATL-HPA075926) Datasheet (External Link)
Vendor Page Anti CEMP1 pAb (ATL-HPA075926) at Atlas Antibodies

Documents & Links for Anti CEMP1 pAb (ATL-HPA075926)
Datasheet Anti CEMP1 pAb (ATL-HPA075926) Datasheet (External Link)
Vendor Page Anti CEMP1 pAb (ATL-HPA075926)