Anti CELSR2 pAb (ATL-HPA013952)

Atlas Antibodies

SKU:
ATL-HPA013952-25
  • Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cadherin, EGF LAG seven-pass G-type receptor 2
Gene Name: CELSR2
Alternative Gene Name: CDHF10, EGFL2, Flamingo1, KIAA0279, MEGF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068740: 95%, ENSRNOG00000020058: 95%
Entrez Gene ID: 1952
Uniprot ID: Q9HCU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SATQDVHFTENLLRVGSALLDTANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPFTIVTPNIVISVVRLDKGNFAGAKLPRYEALRGEQPPDLETTVILPESVFRETPPVVRPAGPGEAQEPEELARRQRRHPELSQ
Gene Sequence SATQDVHFTENLLRVGSALLDTANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPFTIVTPNIVISVVRLDKGNFAGAKLPRYEALRGEQPPDLETTVILPESVFRETPPVVRPAGPGEAQEPEELARRQRRHPELSQ
Gene ID - Mouse ENSMUSG00000068740
Gene ID - Rat ENSRNOG00000020058
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CELSR2 pAb (ATL-HPA013952)
Datasheet Anti CELSR2 pAb (ATL-HPA013952) Datasheet (External Link)
Vendor Page Anti CELSR2 pAb (ATL-HPA013952) at Atlas Antibodies

Documents & Links for Anti CELSR2 pAb (ATL-HPA013952)
Datasheet Anti CELSR2 pAb (ATL-HPA013952) Datasheet (External Link)
Vendor Page Anti CELSR2 pAb (ATL-HPA013952)



Citations for Anti CELSR2 pAb (ATL-HPA013952) – 1 Found
Xu, Mingxing; Zhu, Shu; Xu, Ruiyun; Lin, Nan. Identification of CELSR2 as a novel prognostic biomarker for hepatocellular carcinoma. Bmc Cancer. 2020;20(1):313.  PubMed