Anti CELF4 pAb (ATL-HPA037986 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA037986-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: CUGBP, Elav-like family member 4
Gene Name: CELF4
Alternative Gene Name: BRUNOL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024268: 100%, ENSRNOG00000049802: 100%
Entrez Gene ID: 56853
Uniprot ID: Q9BZC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDH
Gene Sequence MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDH
Gene ID - Mouse ENSMUSG00000024268
Gene ID - Rat ENSRNOG00000049802
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CELF4 pAb (ATL-HPA037986 w/enhanced validation)
Datasheet Anti CELF4 pAb (ATL-HPA037986 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CELF4 pAb (ATL-HPA037986 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CELF4 pAb (ATL-HPA037986 w/enhanced validation)
Datasheet Anti CELF4 pAb (ATL-HPA037986 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CELF4 pAb (ATL-HPA037986 w/enhanced validation)
Citations for Anti CELF4 pAb (ATL-HPA037986 w/enhanced validation) – 2 Found
Sun, Wenzhi; Wagnon, Jacy L; Mahaffey, Connie L; Briese, Michael; Ule, Jernej; Frankel, Wayne N. Aberrant sodium channel activity in the complex seizure disorder of Celf4 mutant mice. The Journal Of Physiology. 2013;591(1):241-55.  PubMed
Wagnon, Jacy L; Briese, Michael; Sun, Wenzhi; Mahaffey, Connie L; Curk, Tomaž; Rot, Gregor; Ule, Jernej; Frankel, Wayne N. CELF4 regulates translation and local abundance of a vast set of mRNAs, including genes associated with regulation of synaptic function. Plos Genetics. 8(11):e1003067.  PubMed