Anti CELF4 pAb (ATL-HPA037986 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037986-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CELF4
Alternative Gene Name: BRUNOL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024268: 100%, ENSRNOG00000049802: 100%
Entrez Gene ID: 56853
Uniprot ID: Q9BZC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDH |
| Gene Sequence | MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDH |
| Gene ID - Mouse | ENSMUSG00000024268 |
| Gene ID - Rat | ENSRNOG00000049802 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CELF4 pAb (ATL-HPA037986 w/enhanced validation) | |
| Datasheet | Anti CELF4 pAb (ATL-HPA037986 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CELF4 pAb (ATL-HPA037986 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CELF4 pAb (ATL-HPA037986 w/enhanced validation) | |
| Datasheet | Anti CELF4 pAb (ATL-HPA037986 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CELF4 pAb (ATL-HPA037986 w/enhanced validation) |
| Citations for Anti CELF4 pAb (ATL-HPA037986 w/enhanced validation) – 2 Found |
| Sun, Wenzhi; Wagnon, Jacy L; Mahaffey, Connie L; Briese, Michael; Ule, Jernej; Frankel, Wayne N. Aberrant sodium channel activity in the complex seizure disorder of Celf4 mutant mice. The Journal Of Physiology. 2013;591(1):241-55. PubMed |
| Wagnon, Jacy L; Briese, Michael; Sun, Wenzhi; Mahaffey, Connie L; Curk, Tomaž; Rot, Gregor; Ule, Jernej; Frankel, Wayne N. CELF4 regulates translation and local abundance of a vast set of mRNAs, including genes associated with regulation of synaptic function. Plos Genetics. 8(11):e1003067. PubMed |