Anti CELF4 pAb (ATL-HPA013322)

Atlas Antibodies

Catalog No.: ATL-HPA013322-25

Protein Description: CUGBP Elav-like family member 4
Gene Name: CELF4
Alternative Gene Name: BRUNOL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024268: 100%, ENSRNOG00000014503: 100%
Entrez Gene ID: 56853
Uniprot ID: Q9BZC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFANGIHPYPAQS
• Gene Sequence: PTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFANGIHPYPAQS
• Gene ID - Mouse: ENSMUSG00000024268
• Gene ID - Rat: ENSRNOG00000014503
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.