Anti CELF4 pAb (ATL-HPA013322)

Atlas Antibodies

Catalog No.:
ATL-HPA013322-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CUGBP Elav-like family member 4
Gene Name: CELF4
Alternative Gene Name: BRUNOL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024268: 100%, ENSRNOG00000014503: 100%
Entrez Gene ID: 56853
Uniprot ID: Q9BZC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFANGIHPYPAQS
Gene Sequence PTSGGSTPPGITAPAVPSIPSPIGVNGFTGLPPQANGQPAAEAVFANGIHPYPAQS
Gene ID - Mouse ENSMUSG00000024268
Gene ID - Rat ENSRNOG00000014503
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CELF4 pAb (ATL-HPA013322)
Datasheet Anti CELF4 pAb (ATL-HPA013322) Datasheet (External Link)
Vendor Page Anti CELF4 pAb (ATL-HPA013322) at Atlas Antibodies

Documents & Links for Anti CELF4 pAb (ATL-HPA013322)
Datasheet Anti CELF4 pAb (ATL-HPA013322) Datasheet (External Link)
Vendor Page Anti CELF4 pAb (ATL-HPA013322)