Anti CELA3A pAb (ATL-HPA045650)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045650-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CELA3A
Alternative Gene Name: ELA3, ELA3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023433: 84%, ENSRNOG00000021619: 82%
Entrez Gene ID: 10136
Uniprot ID: P09093
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASL |
| Gene Sequence | LFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASL |
| Gene ID - Mouse | ENSMUSG00000023433 |
| Gene ID - Rat | ENSRNOG00000021619 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CELA3A pAb (ATL-HPA045650) | |
| Datasheet | Anti CELA3A pAb (ATL-HPA045650) Datasheet (External Link) |
| Vendor Page | Anti CELA3A pAb (ATL-HPA045650) at Atlas Antibodies |
| Documents & Links for Anti CELA3A pAb (ATL-HPA045650) | |
| Datasheet | Anti CELA3A pAb (ATL-HPA045650) Datasheet (External Link) |
| Vendor Page | Anti CELA3A pAb (ATL-HPA045650) |