Anti CELA3A pAb (ATL-HPA028086)

Atlas Antibodies

Catalog No.: ATL-HPA028086-25

Protein Description: chymotrypsin-like elastase family, member 3A
Gene Name: CELA3A
Alternative Gene Name: ELA3, ELA3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023433: 78%, ENSRNOG00000021619: 77%
Entrez Gene ID: 10136
Uniprot ID: P09093
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDIL
• Gene Sequence: HTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDIL
• Gene ID - Mouse: ENSMUSG00000023433
• Gene ID - Rat: ENSRNOG00000021619
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CELA3A pAb (ATL-HPA028086) – 1 Found

Barwinska, Daria; El-Achkar, Tarek M; Melo Ferreira, Ricardo; Syed, Farooq; Cheng, Ying-Hua; Winfree, Seth; Ferkowicz, Michael J; Hato, Takashi; Collins, Kimberly S; Dunn, Kenneth W; Kelly, Katherine J; Sutton, Timothy A; Rovin, Brad H; Parikh, Samir V; Phillips, Carrie L; Dagher, Pierre C; Eadon, Michael T. Molecular characterization of the human kidney interstitium in health and disease. Science Advances. 2021;7(7)