Anti CEL pAb (ATL-HPA052701 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA052701-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CEL
Alternative Gene Name: BSSL, MODY8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026818: 76%, ENSRNOG00000010406: 72%
Entrez Gene ID: 1056
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LEYPMLHYVGFVPVIDGDFIPADPINLYANAADIDYIAGTNNMDGHIFASIDMPAINKGNKKVTEEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQH |
Gene Sequence | LEYPMLHYVGFVPVIDGDFIPADPINLYANAADIDYIAGTNNMDGHIFASIDMPAINKGNKKVTEEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQH |
Gene ID - Mouse | ENSMUSG00000026818 |
Gene ID - Rat | ENSRNOG00000010406 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CEL pAb (ATL-HPA052701 w/enhanced validation) | |
Datasheet | Anti CEL pAb (ATL-HPA052701 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CEL pAb (ATL-HPA052701 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CEL pAb (ATL-HPA052701 w/enhanced validation) | |
Datasheet | Anti CEL pAb (ATL-HPA052701 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CEL pAb (ATL-HPA052701 w/enhanced validation) |
Citations for Anti CEL pAb (ATL-HPA052701 w/enhanced validation) – 2 Found |
El Jellas, Khadija; Johansson, Bente B; Fjeld, Karianne; Antonopoulos, Aristotelis; Immervoll, Heike; Choi, Man H; Hoem, Dag; Lowe, Mark E; Lombardo, Dominique; Njølstad, Pål R; Dell, Anne; Mas, Eric; Haslam, Stuart M; Molven, Anders. The mucinous domain of pancreatic carboxyl-ester lipase (CEL) contains core 1/core 2 O-glycans that can be modified by ABO blood group determinants. The Journal Of Biological Chemistry. 2018;293(50):19476-19491. PubMed |
Dalva, Monica; Lavik, Ida K; El Jellas, Khadija; Gravdal, Anny; Lugea, Aurelia; Pandol, Stephen J; Njølstad, Pål R; Waldron, Richard T; Fjeld, Karianne; Johansson, Bente B; Molven, Anders. Pathogenic Carboxyl Ester Lipase (CEL) Variants Interact with the Normal CEL Protein in Pancreatic Cells. Cells. 2020;9(1) PubMed |