Anti CEL pAb (ATL-HPA008023 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA008023-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: carboxyl ester lipase
Gene Name: CEL
Alternative Gene Name: BSSL, MODY8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026818: 49%, ENSRNOG00000010406: 55%
Entrez Gene ID: 1056
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSG
Gene Sequence HWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSG
Gene ID - Mouse ENSMUSG00000026818
Gene ID - Rat ENSRNOG00000010406
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEL pAb (ATL-HPA008023 w/enhanced validation)
Datasheet Anti CEL pAb (ATL-HPA008023 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CEL pAb (ATL-HPA008023 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CEL pAb (ATL-HPA008023 w/enhanced validation)
Datasheet Anti CEL pAb (ATL-HPA008023 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CEL pAb (ATL-HPA008023 w/enhanced validation)
Citations for Anti CEL pAb (ATL-HPA008023 w/enhanced validation) – 1 Found
Akhter, Firoz; Chen, Doris; Akhter, Asma; Sosunov, Alexander A; Chen, Allen; McKhann, Guy M; Yan, Shi Fang; Yan, Shirley ShiDu. High Dietary Advanced Glycation End Products Impair Mitochondrial and Cognitive Function. Journal Of Alzheimer's Disease : Jad. 76(1):165-178.  PubMed