Anti CEL pAb (ATL-HPA008023 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008023-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CEL
Alternative Gene Name: BSSL, MODY8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026818: 49%, ENSRNOG00000010406: 55%
Entrez Gene ID: 1056
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSG |
| Gene Sequence | HWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSG |
| Gene ID - Mouse | ENSMUSG00000026818 |
| Gene ID - Rat | ENSRNOG00000010406 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEL pAb (ATL-HPA008023 w/enhanced validation) | |
| Datasheet | Anti CEL pAb (ATL-HPA008023 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CEL pAb (ATL-HPA008023 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CEL pAb (ATL-HPA008023 w/enhanced validation) | |
| Datasheet | Anti CEL pAb (ATL-HPA008023 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CEL pAb (ATL-HPA008023 w/enhanced validation) |
| Citations for Anti CEL pAb (ATL-HPA008023 w/enhanced validation) – 1 Found |
| Akhter, Firoz; Chen, Doris; Akhter, Asma; Sosunov, Alexander A; Chen, Allen; McKhann, Guy M; Yan, Shi Fang; Yan, Shirley ShiDu. High Dietary Advanced Glycation End Products Impair Mitochondrial and Cognitive Function. Journal Of Alzheimer's Disease : Jad. 76(1):165-178. PubMed |