Anti CECR1 pAb (ATL-HPA007888)

Atlas Antibodies

Catalog No.:
ATL-HPA007888-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cat eye syndrome chromosome region, candidate 1
Gene Name: CECR1
Alternative Gene Name: ADGF, IDGFL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005686: 24%, ENSRNOG00000018262: 24%
Entrez Gene ID: 51816
Uniprot ID: Q9NZK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDK
Gene Sequence TDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDK
Gene ID - Mouse ENSMUSG00000005686
Gene ID - Rat ENSRNOG00000018262
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CECR1 pAb (ATL-HPA007888)
Datasheet Anti CECR1 pAb (ATL-HPA007888) Datasheet (External Link)
Vendor Page Anti CECR1 pAb (ATL-HPA007888) at Atlas Antibodies

Documents & Links for Anti CECR1 pAb (ATL-HPA007888)
Datasheet Anti CECR1 pAb (ATL-HPA007888) Datasheet (External Link)
Vendor Page Anti CECR1 pAb (ATL-HPA007888)
Citations for Anti CECR1 pAb (ATL-HPA007888) – 2 Found
Zhu, Changbin; Mustafa, Dana A M; Krebber, Merle M; Chrifi, Ihsan; Leenen, Pieter J M; Duncker, Dirk J; Dekker, Lennard; Luider, Theo M; Kros, Johan M; Cheng, Caroline. Comparative proteomic analysis of cat eye syndrome critical region protein 1- function in tumor-associated macrophages and immune response regulation of glial tumors. Oncotarget. 2018;9(71):33500-33514.  PubMed
Dhanwani, Rekha; Takahashi, Mariko; Mathews, Ian T; Lenzi, Camille; Romanov, Artem; Watrous, Jeramie D; Pieters, Bartijn; Hedrick, Catherine C; Benedict, Chris A; Linden, Joel; Nilsson, Roland; Jain, Mohit; Sharma, Sonia. Cellular sensing of extracellular purine nucleosides triggers an innate IFN-β response. Science Advances. 2020;6(30):eaba3688.  PubMed