Anti CEBPZOS pAb (ATL-HPA053866)

Atlas Antibodies

Catalog No.:
ATL-HPA053866-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CEBPZ opposite strand
Gene Name: CEBPZOS
Alternative Gene Name: CEBPZ-AS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062691: 80%, ENSRNOG00000040303: 78%
Entrez Gene ID: 100505876
Uniprot ID: A8MTT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKMHTSQDFRQTMSKKYPFILEVYYKSTEKSGMYGIRELDQ
Gene Sequence SKMHTSQDFRQTMSKKYPFILEVYYKSTEKSGMYGIRELDQ
Gene ID - Mouse ENSMUSG00000062691
Gene ID - Rat ENSRNOG00000040303
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEBPZOS pAb (ATL-HPA053866)
Datasheet Anti CEBPZOS pAb (ATL-HPA053866) Datasheet (External Link)
Vendor Page Anti CEBPZOS pAb (ATL-HPA053866) at Atlas Antibodies

Documents & Links for Anti CEBPZOS pAb (ATL-HPA053866)
Datasheet Anti CEBPZOS pAb (ATL-HPA053866) Datasheet (External Link)
Vendor Page Anti CEBPZOS pAb (ATL-HPA053866)