Anti CEBPG pAb (ATL-HPA012024 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA012024-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CCAAT/enhancer binding protein (C/EBP), gamma
Gene Name: CEBPG
Alternative Gene Name: GPE1BP, IG/EBP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056216: 97%, ENSRNOG00000021144: 98%
Entrez Gene ID: 1054
Uniprot ID: P53567
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENT
Gene Sequence GVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENT
Gene ID - Mouse ENSMUSG00000056216
Gene ID - Rat ENSRNOG00000021144
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEBPG pAb (ATL-HPA012024 w/enhanced validation)
Datasheet Anti CEBPG pAb (ATL-HPA012024 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CEBPG pAb (ATL-HPA012024 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CEBPG pAb (ATL-HPA012024 w/enhanced validation)
Datasheet Anti CEBPG pAb (ATL-HPA012024 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CEBPG pAb (ATL-HPA012024 w/enhanced validation)
Citations for Anti CEBPG pAb (ATL-HPA012024 w/enhanced validation) – 1 Found
Yin, Hui-Min; Yan, Li-Feng; Liu, Qian; Peng, Zheng; Zhang, Chi-Yuan; Xia, Yu; Su, Dan; Gu, Ai-Hua; Zhou, Yong. Activating transcription factor 3 coordinates differentiation of cardiac and hematopoietic progenitors by regulating glucose metabolism. Science Advances. 2020;6(19):eaay9466.  PubMed