Anti CEBPG pAb (ATL-HPA012024 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA012024-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CEBPG
Alternative Gene Name: GPE1BP, IG/EBP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056216: 97%, ENSRNOG00000021144: 98%
Entrez Gene ID: 1054
Uniprot ID: P53567
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENT |
Gene Sequence | GVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENT |
Gene ID - Mouse | ENSMUSG00000056216 |
Gene ID - Rat | ENSRNOG00000021144 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CEBPG pAb (ATL-HPA012024 w/enhanced validation) | |
Datasheet | Anti CEBPG pAb (ATL-HPA012024 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CEBPG pAb (ATL-HPA012024 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CEBPG pAb (ATL-HPA012024 w/enhanced validation) | |
Datasheet | Anti CEBPG pAb (ATL-HPA012024 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CEBPG pAb (ATL-HPA012024 w/enhanced validation) |
Citations for Anti CEBPG pAb (ATL-HPA012024 w/enhanced validation) – 1 Found |
Yin, Hui-Min; Yan, Li-Feng; Liu, Qian; Peng, Zheng; Zhang, Chi-Yuan; Xia, Yu; Su, Dan; Gu, Ai-Hua; Zhou, Yong. Activating transcription factor 3 coordinates differentiation of cardiac and hematopoietic progenitors by regulating glucose metabolism. Science Advances. 2020;6(19):eaay9466. PubMed |