Anti CEBPE pAb (ATL-HPA002928 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002928-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CEBPE
Alternative Gene Name: CRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052435: 94%, ENSRNOG00000014282: 94%
Entrez Gene ID: 1053
Uniprot ID: Q15744
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPR |
| Gene Sequence | SHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPR |
| Gene ID - Mouse | ENSMUSG00000052435 |
| Gene ID - Rat | ENSRNOG00000014282 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEBPE pAb (ATL-HPA002928 w/enhanced validation) | |
| Datasheet | Anti CEBPE pAb (ATL-HPA002928 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CEBPE pAb (ATL-HPA002928 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CEBPE pAb (ATL-HPA002928 w/enhanced validation) | |
| Datasheet | Anti CEBPE pAb (ATL-HPA002928 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CEBPE pAb (ATL-HPA002928 w/enhanced validation) |
| Citations for Anti CEBPE pAb (ATL-HPA002928 w/enhanced validation) – 1 Found |
| Serwas, Nina K; Huemer, Jakob; Dieckmann, Régis; Mejstrikova, Ester; Garncarz, Wojciech; Litzman, Jiri; Hoeger, Birgit; Zapletal, Ondrej; Janda, Ales; Bennett, Keiryn L; Kain, Renate; Kerjaschky, Dontscho; Boztug, Kaan. CEBPE-Mutant Specific Granule Deficiency Correlates With Aberrant Granule Organization and Substantial Proteome Alterations in Neutrophils. Frontiers In Immunology. 9( 29651288):588. PubMed |