Anti CEBPE pAb (ATL-HPA002928 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA002928-25

• 
• 
• 

Protein Description: CCAAT/enhancer binding protein (C/EBP), epsilon
Gene Name: CEBPE
Alternative Gene Name: CRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052435: 94%, ENSRNOG00000014282: 94%
Entrez Gene ID: 1053
Uniprot ID: Q15744
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPR
• Gene Sequence: SHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPR
• Gene ID - Mouse: ENSMUSG00000052435
• Gene ID - Rat: ENSRNOG00000014282
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CEBPE pAb (ATL-HPA002928 w/enhanced validation) – 1 Found

Serwas, Nina K; Huemer, Jakob; Dieckmann, Régis; Mejstrikova, Ester; Garncarz, Wojciech; Litzman, Jiri; Hoeger, Birgit; Zapletal, Ondrej; Janda, Ales; Bennett, Keiryn L; Kain, Renate; Kerjaschky, Dontscho; Boztug, Kaan. CEBPE-Mutant Specific Granule Deficiency Correlates With Aberrant Granule Organization and Substantial Proteome Alterations in Neutrophils. Frontiers In Immunology. 9( 29651288):588.