Anti CEBPD pAb (ATL-HPA067581)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067581-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CEBPD
Alternative Gene Name: C/EBP-delta, CELF, CRP3, NF-IL6-beta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071637: 93%, ENSRNOG00000050869: 91%
Entrez Gene ID: 1052
Uniprot ID: P49716
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR |
| Gene Sequence | AKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR |
| Gene ID - Mouse | ENSMUSG00000071637 |
| Gene ID - Rat | ENSRNOG00000050869 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEBPD pAb (ATL-HPA067581) | |
| Datasheet | Anti CEBPD pAb (ATL-HPA067581) Datasheet (External Link) |
| Vendor Page | Anti CEBPD pAb (ATL-HPA067581) at Atlas Antibodies |
| Documents & Links for Anti CEBPD pAb (ATL-HPA067581) | |
| Datasheet | Anti CEBPD pAb (ATL-HPA067581) Datasheet (External Link) |
| Vendor Page | Anti CEBPD pAb (ATL-HPA067581) |