Anti CEBPD pAb (ATL-HPA067581)

Atlas Antibodies

Catalog No.: ATL-HPA067581-25

Protein Description: CCAAT/enhancer binding protein (C/EBP), delta
Gene Name: CEBPD
Alternative Gene Name: C/EBP-delta, CELF, CRP3, NF-IL6-beta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071637: 93%, ENSRNOG00000050869: 91%
Entrez Gene ID: 1052
Uniprot ID: P49716
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR
• Gene Sequence: AKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR
• Gene ID - Mouse: ENSMUSG00000071637
• Gene ID - Rat: ENSRNOG00000050869
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.