Anti CEACAM7 pAb (ATL-HPA069621)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069621-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CEACAM7
Alternative Gene Name: CEA, CGM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063305: 47%, ENSRNOG00000042250: 43%
Entrez Gene ID: 1087
Uniprot ID: Q14002
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RVHANYRIIGYVKNISQENAPGPAHNGRET |
| Gene Sequence | RVHANYRIIGYVKNISQENAPGPAHNGRET |
| Gene ID - Mouse | ENSMUSG00000063305 |
| Gene ID - Rat | ENSRNOG00000042250 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CEACAM7 pAb (ATL-HPA069621) | |
| Datasheet | Anti CEACAM7 pAb (ATL-HPA069621) Datasheet (External Link) |
| Vendor Page | Anti CEACAM7 pAb (ATL-HPA069621) at Atlas Antibodies |
| Documents & Links for Anti CEACAM7 pAb (ATL-HPA069621) | |
| Datasheet | Anti CEACAM7 pAb (ATL-HPA069621) Datasheet (External Link) |
| Vendor Page | Anti CEACAM7 pAb (ATL-HPA069621) |