Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA019758-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: carcinoembryonic antigen-related cell adhesion molecule 5
Gene Name: CEACAM5
Alternative Gene Name: CD66e, CEA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054385: 50%, ENSRNOG00000020578: 49%
Entrez Gene ID: 1048
Uniprot ID: P06731
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQN
Gene Sequence QELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQN
Gene ID - Mouse ENSMUSG00000054385
Gene ID - Rat ENSRNOG00000020578
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation)
Datasheet Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation)
Datasheet Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation)
Citations for Anti CEACAM5 pAb (ATL-HPA019758 w/enhanced validation) – 1 Found
Gonzalez-Exposito, Reyes; Semiannikova, Maria; Griffiths, Beatrice; Khan, Khurum; Barber, Louise J; Woolston, Andrew; Spain, Georgia; von Loga, Katharina; Challoner, Ben; Patel, Radhika; Ranes, Michael; Swain, Amanda; Thomas, Janet; Bryant, Annette; Saffery, Claire; Fotiadis, Nicos; Guettler, Sebastian; Mansfield, David; Melcher, Alan; Powles, Thomas; Rao, Sheela; Watkins, David; Chau, Ian; Matthews, Nik; Wallberg, Fredrik; Starling, Naureen; Cunningham, David; Gerlinger, Marco. CEA expression heterogeneity and plasticity confer resistance to the CEA-targeting bispecific immunotherapy antibody cibisatamab (CEA-TCB) in patient-derived colorectal cancer organoids. Journal For Immunotherapy Of Cancer. 2019;7(1):101.  PubMed