Anti CEACAM21 pAb (ATL-HPA043411)

Atlas Antibodies

SKU: ATL-HPA043411-25

• 

Protein Description: carcinoembryonic antigen-related cell adhesion molecule 21
Gene Name: CEACAM21
Alternative Gene Name: FLJ13540, R29124_1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053228: 50%, ENSRNOG00000042250: 46%
Entrez Gene ID: 90273
Uniprot ID: Q3KPI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGP
• Gene Sequence: IASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGP
• Gene ID - Mouse: ENSMUSG00000053228
• Gene ID - Rat: ENSRNOG00000042250
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.