Anti CEACAM21 pAb (ATL-HPA043411)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043411-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CEACAM21
Alternative Gene Name: FLJ13540, R29124_1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053228: 50%, ENSRNOG00000042250: 46%
Entrez Gene ID: 90273
Uniprot ID: Q3KPI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGP |
Gene Sequence | IASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGP |
Gene ID - Mouse | ENSMUSG00000053228 |
Gene ID - Rat | ENSRNOG00000042250 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CEACAM21 pAb (ATL-HPA043411) | |
Datasheet | Anti CEACAM21 pAb (ATL-HPA043411) Datasheet (External Link) |
Vendor Page | Anti CEACAM21 pAb (ATL-HPA043411) at Atlas Antibodies |
Documents & Links for Anti CEACAM21 pAb (ATL-HPA043411) | |
Datasheet | Anti CEACAM21 pAb (ATL-HPA043411) Datasheet (External Link) |
Vendor Page | Anti CEACAM21 pAb (ATL-HPA043411) |