Anti CEACAM21 pAb (ATL-HPA043411)

Atlas Antibodies

Catalog No.:
ATL-HPA043411-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: carcinoembryonic antigen-related cell adhesion molecule 21
Gene Name: CEACAM21
Alternative Gene Name: FLJ13540, R29124_1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053228: 50%, ENSRNOG00000042250: 46%
Entrez Gene ID: 90273
Uniprot ID: Q3KPI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGP
Gene Sequence IASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGP
Gene ID - Mouse ENSMUSG00000053228
Gene ID - Rat ENSRNOG00000042250
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEACAM21 pAb (ATL-HPA043411)
Datasheet Anti CEACAM21 pAb (ATL-HPA043411) Datasheet (External Link)
Vendor Page Anti CEACAM21 pAb (ATL-HPA043411) at Atlas Antibodies

Documents & Links for Anti CEACAM21 pAb (ATL-HPA043411)
Datasheet Anti CEACAM21 pAb (ATL-HPA043411) Datasheet (External Link)
Vendor Page Anti CEACAM21 pAb (ATL-HPA043411)