Anti CEACAM19 pAb (ATL-HPA014462)

Atlas Antibodies

SKU:
ATL-HPA014462-25
  • Immunohistochemical staining of human gall bladder shows strong nuclear positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: carcinoembryonic antigen-related cell adhesion molecule 19
Gene Name: CEACAM19
Alternative Gene Name: CEAL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049848: 37%, ENSRNOG00000043088: 38%
Entrez Gene ID: 56971
Uniprot ID: Q7Z692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TRNWRGQSHRLPAPRGQGSLSILCSAVSPVPSVTPSTWMATTEKPELGPAHDAGDNNIYEVMPSPVLLVSPISDTRSINPARPLPTPPHLQAEPENHQYQQDLLNPDPA
Gene Sequence TRNWRGQSHRLPAPRGQGSLSILCSAVSPVPSVTPSTWMATTEKPELGPAHDAGDNNIYEVMPSPVLLVSPISDTRSINPARPLPTPPHLQAEPENHQYQQDLLNPDPA
Gene ID - Mouse ENSMUSG00000049848
Gene ID - Rat ENSRNOG00000043088
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CEACAM19 pAb (ATL-HPA014462)
Datasheet Anti CEACAM19 pAb (ATL-HPA014462) Datasheet (External Link)
Vendor Page Anti CEACAM19 pAb (ATL-HPA014462) at Atlas Antibodies

Documents & Links for Anti CEACAM19 pAb (ATL-HPA014462)
Datasheet Anti CEACAM19 pAb (ATL-HPA014462) Datasheet (External Link)
Vendor Page Anti CEACAM19 pAb (ATL-HPA014462)