Anti CEACAM16 pAb (ATL-HPA045075)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045075-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CEACAM16
Alternative Gene Name: DFNA4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014686: 96%, ENSRNOG00000031391: 95%
Entrez Gene ID: 388551
Uniprot ID: Q2WEN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKT |
Gene Sequence | VPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKT |
Gene ID - Mouse | ENSMUSG00000014686 |
Gene ID - Rat | ENSRNOG00000031391 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CEACAM16 pAb (ATL-HPA045075) | |
Datasheet | Anti CEACAM16 pAb (ATL-HPA045075) Datasheet (External Link) |
Vendor Page | Anti CEACAM16 pAb (ATL-HPA045075) at Atlas Antibodies |
Documents & Links for Anti CEACAM16 pAb (ATL-HPA045075) | |
Datasheet | Anti CEACAM16 pAb (ATL-HPA045075) Datasheet (External Link) |
Vendor Page | Anti CEACAM16 pAb (ATL-HPA045075) |