Anti CEACAM1 pAb (ATL-HPA011041)

Atlas Antibodies

SKU: ATL-HPA011041-25

• 

Protein Description: carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein)
Gene Name: CEACAM1
Alternative Gene Name: BGP, BGP1, CD66a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053228: 48%, ENSRNOG00000027607: 48%
Entrez Gene ID: 634
Uniprot ID: P13688
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQE
• Gene Sequence: NVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQE
• Gene ID - Mouse: ENSMUSG00000053228
• Gene ID - Rat: ENSRNOG00000027607
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.