Anti CEACAM1 pAb (ATL-HPA011041)

Atlas Antibodies

Catalog No.:
ATL-HPA011041-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein)
Gene Name: CEACAM1
Alternative Gene Name: BGP, BGP1, CD66a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053228: 48%, ENSRNOG00000027607: 48%
Entrez Gene ID: 634
Uniprot ID: P13688
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQE
Gene Sequence NVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQE
Gene ID - Mouse ENSMUSG00000053228
Gene ID - Rat ENSRNOG00000027607
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CEACAM1 pAb (ATL-HPA011041)
Datasheet Anti CEACAM1 pAb (ATL-HPA011041) Datasheet (External Link)
Vendor Page Anti CEACAM1 pAb (ATL-HPA011041) at Atlas Antibodies

Documents & Links for Anti CEACAM1 pAb (ATL-HPA011041)
Datasheet Anti CEACAM1 pAb (ATL-HPA011041) Datasheet (External Link)
Vendor Page Anti CEACAM1 pAb (ATL-HPA011041)