Anti CDYL2 pAb (ATL-HPA041016)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041016-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CDYL2
Alternative Gene Name: FLJ38866
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031758: 84%, ENSRNOG00000042888: 82%
Entrez Gene ID: 124359
Uniprot ID: Q8N8U2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFNGLHMSKDKRIKSGKQSSTSKLLRDSRGPSVEKLSHRPSDPGKSKGTSHKRKRINPPL |
Gene Sequence | GKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFNGLHMSKDKRIKSGKQSSTSKLLRDSRGPSVEKLSHRPSDPGKSKGTSHKRKRINPPL |
Gene ID - Mouse | ENSMUSG00000031758 |
Gene ID - Rat | ENSRNOG00000042888 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDYL2 pAb (ATL-HPA041016) | |
Datasheet | Anti CDYL2 pAb (ATL-HPA041016) Datasheet (External Link) |
Vendor Page | Anti CDYL2 pAb (ATL-HPA041016) at Atlas Antibodies |
Documents & Links for Anti CDYL2 pAb (ATL-HPA041016) | |
Datasheet | Anti CDYL2 pAb (ATL-HPA041016) Datasheet (External Link) |
Vendor Page | Anti CDYL2 pAb (ATL-HPA041016) |