Anti CDYL pAb (ATL-HPA035578 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035578-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CDYL
Alternative Gene Name: CDYL1, DKFZP586C1622
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059288: 89%, ENSRNOG00000032215: 77%
Entrez Gene ID: 9425
Uniprot ID: Q9Y232
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PVKSRTAVDGFQSESPEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAERARMGSRPRIHP |
Gene Sequence | PVKSRTAVDGFQSESPEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAERARMGSRPRIHP |
Gene ID - Mouse | ENSMUSG00000059288 |
Gene ID - Rat | ENSRNOG00000032215 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDYL pAb (ATL-HPA035578 w/enhanced validation) | |
Datasheet | Anti CDYL pAb (ATL-HPA035578 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CDYL pAb (ATL-HPA035578 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CDYL pAb (ATL-HPA035578 w/enhanced validation) | |
Datasheet | Anti CDYL pAb (ATL-HPA035578 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CDYL pAb (ATL-HPA035578 w/enhanced validation) |
Citations for Anti CDYL pAb (ATL-HPA035578 w/enhanced validation) – 3 Found |
Sun, Zhao-Wei; Waybright, Jarod M; Beldar, Serap; Chen, Lu; Foley, Caroline A; Norris-Drouin, Jacqueline L; Lyu, Tian-Jie; Dong, Aiping; Min, Jinrong; Wang, Yu-Pu; James, Lindsey I; Wang, Yun. Cdyl Deficiency Brakes Neuronal Excitability and Nociception through Promoting Kcnb1 Transcription in Peripheral Sensory Neurons. Advanced Science (Weinheim, Baden-Wurttemberg, Germany). 2022;9(10):e2104317. PubMed |
Liu, Yongqing; Lai, Shirong; Ma, Weining; Ke, Wei; Zhang, Chan; Liu, Shumeng; Zhang, Yu; Pei, Fei; Li, Shaoyi; Yi, Ming; Shu, Yousheng; Shang, Yongfeng; Liang, Jing; Huang, Zhuo. CDYL suppresses epileptogenesis in mice through repression of axonal Nav1.6 sodium channel expression. Nature Communications. 2017;8(1):355. PubMed |
Yu, Huajing; Bu, Chen; Liu, Yuncheng; Gong, Tianyu; Liu, Xiaoping; Liu, Shumeng; Peng, Xiaojun; Zhang, Wenting; Peng, Yani; Yang, Jianguo; He, Lin; Zhang, Yu; Yi, Xia; Yang, Xiaohan; Sun, Luyang; Shang, Yongfeng; Cheng, Zhongyi; Liang, Jing. Global crotonylome reveals CDYL-regulated RPA1 crotonylation in homologous recombination-mediated DNA repair. Science Advances. 2020;6(11):eaay4697. PubMed |