Anti CDY2B pAb (ATL-HPA066682)

Atlas Antibodies

Catalog No.:
ATL-HPA066682-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromodomain Y-linked 2B
Gene Name: CDY2B
Alternative Gene Name: CDY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059288: 38%, ENSRNOG00000032215: 41%
Entrez Gene ID: 203611
Uniprot ID: Q9Y6F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RQTEKQKKLTWTTTSRIFSNNARRRTSRSTKANYSKNSP
Gene Sequence RQTEKQKKLTWTTTSRIFSNNARRRTSRSTKANYSKNSP
Gene ID - Mouse ENSMUSG00000059288
Gene ID - Rat ENSRNOG00000032215
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDY2B pAb (ATL-HPA066682)
Datasheet Anti CDY2B pAb (ATL-HPA066682) Datasheet (External Link)
Vendor Page Anti CDY2B pAb (ATL-HPA066682) at Atlas Antibodies

Documents & Links for Anti CDY2B pAb (ATL-HPA066682)
Datasheet Anti CDY2B pAb (ATL-HPA066682) Datasheet (External Link)
Vendor Page Anti CDY2B pAb (ATL-HPA066682)