Anti CDX4 pAb (ATL-HPA056528)

Atlas Antibodies

Catalog No.:
ATL-HPA056528-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: caudal type homeobox 4
Gene Name: CDX4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031326: 95%, ENSRNOG00000002974: 95%
Entrez Gene ID: 1046
Uniprot ID: O14627
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE
Gene Sequence RAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE
Gene ID - Mouse ENSMUSG00000031326
Gene ID - Rat ENSRNOG00000002974
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDX4 pAb (ATL-HPA056528)
Datasheet Anti CDX4 pAb (ATL-HPA056528) Datasheet (External Link)
Vendor Page Anti CDX4 pAb (ATL-HPA056528) at Atlas Antibodies

Documents & Links for Anti CDX4 pAb (ATL-HPA056528)
Datasheet Anti CDX4 pAb (ATL-HPA056528) Datasheet (External Link)
Vendor Page Anti CDX4 pAb (ATL-HPA056528)