Anti CDX4 pAb (ATL-HPA056528)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056528-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CDX4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031326: 95%, ENSRNOG00000002974: 95%
Entrez Gene ID: 1046
Uniprot ID: O14627
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE |
| Gene Sequence | RAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE |
| Gene ID - Mouse | ENSMUSG00000031326 |
| Gene ID - Rat | ENSRNOG00000002974 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDX4 pAb (ATL-HPA056528) | |
| Datasheet | Anti CDX4 pAb (ATL-HPA056528) Datasheet (External Link) |
| Vendor Page | Anti CDX4 pAb (ATL-HPA056528) at Atlas Antibodies |
| Documents & Links for Anti CDX4 pAb (ATL-HPA056528) | |
| Datasheet | Anti CDX4 pAb (ATL-HPA056528) Datasheet (External Link) |
| Vendor Page | Anti CDX4 pAb (ATL-HPA056528) |