Anti CDX2 pAb (ATL-HPA045669)

Atlas Antibodies

Catalog No.:
ATL-HPA045669-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: caudal type homeobox 2
Gene Name: CDX2
Alternative Gene Name: CDX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029646: 100%, ENSRNOG00000032759: 100%
Entrez Gene ID: 1045
Uniprot ID: Q99626
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVA
Gene Sequence MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVA
Gene ID - Mouse ENSMUSG00000029646
Gene ID - Rat ENSRNOG00000032759
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDX2 pAb (ATL-HPA045669)
Datasheet Anti CDX2 pAb (ATL-HPA045669) Datasheet (External Link)
Vendor Page Anti CDX2 pAb (ATL-HPA045669) at Atlas Antibodies

Documents & Links for Anti CDX2 pAb (ATL-HPA045669)
Datasheet Anti CDX2 pAb (ATL-HPA045669) Datasheet (External Link)
Vendor Page Anti CDX2 pAb (ATL-HPA045669)