Anti CDV3 pAb (ATL-HPA029763 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029763-25

Protein Description: CDV3 homolog (mouse)
Gene Name: CDV3
Alternative Gene Name: H41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032803: 86%, ENSRNOG00000010186: 88%
Entrez Gene ID: 55573
Uniprot ID: Q9UKY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KAVTKDEDEWKELEQKEVDYSGLRVQAMQISSEKEEDDNEKRQDPGDNWEE
• Gene Sequence: KAVTKDEDEWKELEQKEVDYSGLRVQAMQISSEKEEDDNEKRQDPGDNWEE
• Gene ID - Mouse: ENSMUSG00000032803
• Gene ID - Rat: ENSRNOG00000010186
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.