Anti CDV3 pAb (ATL-HPA029761 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA029761-25
  • Immunohistochemical staining of human cerebral cortex, liver, lymph node and tonsil using Anti-CDV3 antibody HPA029761 (A) shows similar protein distribution across tissues to independent antibody HPA029762 (B).
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoli, plasma membrane & cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CDV3 homolog (mouse)
Gene Name: CDV3
Alternative Gene Name: H41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032803: 97%, ENSRNOG00000010186: 95%
Entrez Gene ID: 55573
Uniprot ID: Q9UKY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SGPWNKTAPVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPS
Gene Sequence SGPWNKTAPVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPS
Gene ID - Mouse ENSMUSG00000032803
Gene ID - Rat ENSRNOG00000010186
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDV3 pAb (ATL-HPA029761 w/enhanced validation)
Datasheet Anti CDV3 pAb (ATL-HPA029761 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDV3 pAb (ATL-HPA029761 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CDV3 pAb (ATL-HPA029761 w/enhanced validation)
Datasheet Anti CDV3 pAb (ATL-HPA029761 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDV3 pAb (ATL-HPA029761 w/enhanced validation)