Anti CDSN pAb (ATL-HPA044730 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044730-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CDSN
Alternative Gene Name: D6S586E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039518: 61%, ENSRNOG00000005934: 31%
Entrez Gene ID: 1041
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPG |
| Gene Sequence | SALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPG |
| Gene ID - Mouse | ENSMUSG00000039518 |
| Gene ID - Rat | ENSRNOG00000005934 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) | |
| Datasheet | Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) | |
| Datasheet | Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) |
| Citations for Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) – 1 Found |
| Narda, Mridvika; Trullas, Carles; Brown, Anthony; Piquero-Casals, Jaime; Granger, Corinne; Fabbrocini, Gabriella. Glycolic acid adjusted to pH 4 stimulates collagen production and epidermal renewal without affecting levels of proinflammatory TNF-alpha in human skin explants. Journal Of Cosmetic Dermatology. 2021;20(2):513-521. PubMed |