Anti CDSN pAb (ATL-HPA044730 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA044730-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: corneodesmosin
Gene Name: CDSN
Alternative Gene Name: D6S586E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039518: 61%, ENSRNOG00000005934: 31%
Entrez Gene ID: 1041
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPG
Gene Sequence SALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPG
Gene ID - Mouse ENSMUSG00000039518
Gene ID - Rat ENSRNOG00000005934
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDSN pAb (ATL-HPA044730 w/enhanced validation)
Datasheet Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CDSN pAb (ATL-HPA044730 w/enhanced validation)
Datasheet Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDSN pAb (ATL-HPA044730 w/enhanced validation)
Citations for Anti CDSN pAb (ATL-HPA044730 w/enhanced validation) – 1 Found
Narda, Mridvika; Trullas, Carles; Brown, Anthony; Piquero-Casals, Jaime; Granger, Corinne; Fabbrocini, Gabriella. Glycolic acid adjusted to pH 4 stimulates collagen production and epidermal renewal without affecting levels of proinflammatory TNF-alpha in human skin explants. Journal Of Cosmetic Dermatology. 2021;20(2):513-521.  PubMed