Anti CDS2 pAb (ATL-HPA019698)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019698-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CDS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058793: 88%, ENSRNOG00000021265: 85%
Entrez Gene ID: 8760
Uniprot ID: O95674
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK |
| Gene Sequence | MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK |
| Gene ID - Mouse | ENSMUSG00000058793 |
| Gene ID - Rat | ENSRNOG00000021265 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDS2 pAb (ATL-HPA019698) | |
| Datasheet | Anti CDS2 pAb (ATL-HPA019698) Datasheet (External Link) |
| Vendor Page | Anti CDS2 pAb (ATL-HPA019698) at Atlas Antibodies |
| Documents & Links for Anti CDS2 pAb (ATL-HPA019698) | |
| Datasheet | Anti CDS2 pAb (ATL-HPA019698) Datasheet (External Link) |
| Vendor Page | Anti CDS2 pAb (ATL-HPA019698) |