Anti CDS2 pAb (ATL-HPA019698)

Atlas Antibodies

Catalog No.:
ATL-HPA019698-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
Gene Name: CDS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058793: 88%, ENSRNOG00000021265: 85%
Entrez Gene ID: 8760
Uniprot ID: O95674
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK
Gene Sequence MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK
Gene ID - Mouse ENSMUSG00000058793
Gene ID - Rat ENSRNOG00000021265
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDS2 pAb (ATL-HPA019698)
Datasheet Anti CDS2 pAb (ATL-HPA019698) Datasheet (External Link)
Vendor Page Anti CDS2 pAb (ATL-HPA019698) at Atlas Antibodies

Documents & Links for Anti CDS2 pAb (ATL-HPA019698)
Datasheet Anti CDS2 pAb (ATL-HPA019698) Datasheet (External Link)
Vendor Page Anti CDS2 pAb (ATL-HPA019698)