Anti CDS2 pAb (ATL-HPA019698)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019698-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CDS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058793: 88%, ENSRNOG00000021265: 85%
Entrez Gene ID: 8760
Uniprot ID: O95674
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK |
Gene Sequence | MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK |
Gene ID - Mouse | ENSMUSG00000058793 |
Gene ID - Rat | ENSRNOG00000021265 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDS2 pAb (ATL-HPA019698) | |
Datasheet | Anti CDS2 pAb (ATL-HPA019698) Datasheet (External Link) |
Vendor Page | Anti CDS2 pAb (ATL-HPA019698) at Atlas Antibodies |
Documents & Links for Anti CDS2 pAb (ATL-HPA019698) | |
Datasheet | Anti CDS2 pAb (ATL-HPA019698) Datasheet (External Link) |
Vendor Page | Anti CDS2 pAb (ATL-HPA019698) |