Anti CDS1 pAb (ATL-HPA036187)

Atlas Antibodies

SKU:
ATL-HPA036187-25
  • Immunohistochemical staining of human fallopian tube shows moderate membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nuclear membrane.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1
Gene Name: CDS1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029330: 91%, ENSRNOG00000002142: 91%
Entrez Gene ID: 1040
Uniprot ID: Q92903
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQ
Gene Sequence YQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQ
Gene ID - Mouse ENSMUSG00000029330
Gene ID - Rat ENSRNOG00000002142
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDS1 pAb (ATL-HPA036187)
Datasheet Anti CDS1 pAb (ATL-HPA036187) Datasheet (External Link)
Vendor Page Anti CDS1 pAb (ATL-HPA036187) at Atlas Antibodies

Documents & Links for Anti CDS1 pAb (ATL-HPA036187)
Datasheet Anti CDS1 pAb (ATL-HPA036187) Datasheet (External Link)
Vendor Page Anti CDS1 pAb (ATL-HPA036187)