Anti CDS1 pAb (ATL-HPA036187)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036187-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CDS1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029330: 91%, ENSRNOG00000002142: 91%
Entrez Gene ID: 1040
Uniprot ID: Q92903
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQ |
| Gene Sequence | YQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQ |
| Gene ID - Mouse | ENSMUSG00000029330 |
| Gene ID - Rat | ENSRNOG00000002142 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDS1 pAb (ATL-HPA036187) | |
| Datasheet | Anti CDS1 pAb (ATL-HPA036187) Datasheet (External Link) |
| Vendor Page | Anti CDS1 pAb (ATL-HPA036187) at Atlas Antibodies |
| Documents & Links for Anti CDS1 pAb (ATL-HPA036187) | |
| Datasheet | Anti CDS1 pAb (ATL-HPA036187) Datasheet (External Link) |
| Vendor Page | Anti CDS1 pAb (ATL-HPA036187) |