Anti CDR2L pAb (ATL-HPA022015 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA022015-25

• 
• 
• 

Protein Description: cerebellar degeneration-related protein 2-like
Gene Name: CDR2L
Alternative Gene Name: HUMPPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050910: 93%, ENSRNOG00000025815: 94%
Entrez Gene ID: 30850
Uniprot ID: Q86X02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINATKVKTHSS
• Gene Sequence: DSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINATKVKTHSS
• Gene ID - Mouse: ENSMUSG00000050910
• Gene ID - Rat: ENSRNOG00000025815
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDR2L pAb (ATL-HPA022015 w/enhanced validation) – 3 Found

Eichler, Tilo W; Totland, Cecilie; Haugen, Mette; Qvale, Tor H; Mazengia, Kibret; Storstein, Anette; Haukanes, Bjørn I; Vedeler, Christian A. CDR2L Antibodies: A New Player in Paraneoplastic Cerebellar Degeneration. Plos One. 8(6):e66002. 

Schubert, Manja; Panja, Debabrata; Haugen, Mette; Bramham, Clive R; Vedeler, Christian A. Paraneoplastic CDR2 and CDR2L antibodies affect Purkinje cell calcium homeostasis. Acta Neuropathologica. 2014;128(6):835-52. 

Panja, D; Vedeler, C A; Schubert, M. Paraneoplastic cerebellar degeneration: Yo antibody alters mitochondrial calcium buffering capacity. Neuropathology And Applied Neurobiology. 2019;45(2):141-156.