Anti CDPF1 pAb (ATL-HPA018823)

Atlas Antibodies

Catalog No.: ATL-HPA018823-25

Protein Description: cysteine-rich, DPF motif domain containing 1
Gene Name: CDPF1
Alternative Gene Name: C22orf40, LOC150383
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064284: 80%, ENSRNOG00000017518: 23%
Entrez Gene ID: 150383
Uniprot ID: Q6NVV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RPLGVFECELCTLTAPYSYVGQKPPNTQSMVLLEESYVMKDPFTSDKDRFLVLGSCCSLCSRLVCVGPECSLFYSKRFCLPCVRENINAFPQEIRQDLEKRKAPSK
• Gene Sequence: RPLGVFECELCTLTAPYSYVGQKPPNTQSMVLLEESYVMKDPFTSDKDRFLVLGSCCSLCSRLVCVGPECSLFYSKRFCLPCVRENINAFPQEIRQDLEKRKAPSK
• Gene ID - Mouse: ENSMUSG00000064284
• Gene ID - Rat: ENSRNOG00000017518
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.