Anti CDNF pAb (ATL-HPA044587)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044587-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CDNF
Alternative Gene Name: ARMETL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039496: 81%, ENSRNOG00000026493: 85%
Entrez Gene ID: 441549
Uniprot ID: Q49AH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATH |
Gene Sequence | TLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATH |
Gene ID - Mouse | ENSMUSG00000039496 |
Gene ID - Rat | ENSRNOG00000026493 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDNF pAb (ATL-HPA044587) | |
Datasheet | Anti CDNF pAb (ATL-HPA044587) Datasheet (External Link) |
Vendor Page | Anti CDNF pAb (ATL-HPA044587) at Atlas Antibodies |
Documents & Links for Anti CDNF pAb (ATL-HPA044587) | |
Datasheet | Anti CDNF pAb (ATL-HPA044587) Datasheet (External Link) |
Vendor Page | Anti CDNF pAb (ATL-HPA044587) |
Citations for Anti CDNF pAb (ATL-HPA044587) – 1 Found |
Tseng, Kuan-Yin; Stratoulias, Vassilis; Hu, Wei-Fen; Wu, Jui-Sheng; Wang, Vicki; Chen, Yuan-Hao; Seelbach, Anna; Huttunen, Henri J; Kulesskaya, Natalia; Pang, Cheng-Yoong; Chou, Jian-Liang; Lindahl, Maria; Saarma, Mart; Huang, Li-Chuan; Airavaara, Mikko; Liew, Hock-Kean. Augmenting hematoma-scavenging capacity of innate immune cells by CDNF reduces brain injury and promotes functional recovery after intracerebral hemorrhage. Cell Death & Disease. 2023;14(2):128. PubMed |