Anti CDKN3 pAb (ATL-HPA058874)

Atlas Antibodies

Catalog No.:
ATL-HPA058874-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cyclin-dependent kinase inhibitor 3
Gene Name: CDKN3
Alternative Gene Name: CDI1, KAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037628: 90%, ENSRNOG00000009785: 90%
Entrez Gene ID: 1033
Uniprot ID: Q16667
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Gene Sequence TISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Gene ID - Mouse ENSMUSG00000037628
Gene ID - Rat ENSRNOG00000009785
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDKN3 pAb (ATL-HPA058874)
Datasheet Anti CDKN3 pAb (ATL-HPA058874) Datasheet (External Link)
Vendor Page Anti CDKN3 pAb (ATL-HPA058874) at Atlas Antibodies

Documents & Links for Anti CDKN3 pAb (ATL-HPA058874)
Datasheet Anti CDKN3 pAb (ATL-HPA058874) Datasheet (External Link)
Vendor Page Anti CDKN3 pAb (ATL-HPA058874)