Anti CDKN2D pAb (ATL-HPA043546)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043546-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CDKN2D
Alternative Gene Name: INK4D, p19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096472: 79%, ENSRNOG00000008956: 45%
Entrez Gene ID: 1032
Uniprot ID: P55273
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDAR |
Gene Sequence | FLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDAR |
Gene ID - Mouse | ENSMUSG00000096472 |
Gene ID - Rat | ENSRNOG00000008956 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDKN2D pAb (ATL-HPA043546) | |
Datasheet | Anti CDKN2D pAb (ATL-HPA043546) Datasheet (External Link) |
Vendor Page | Anti CDKN2D pAb (ATL-HPA043546) at Atlas Antibodies |
Documents & Links for Anti CDKN2D pAb (ATL-HPA043546) | |
Datasheet | Anti CDKN2D pAb (ATL-HPA043546) Datasheet (External Link) |
Vendor Page | Anti CDKN2D pAb (ATL-HPA043546) |
Citations for Anti CDKN2D pAb (ATL-HPA043546) – 1 Found |
Dehkordi, Shiva Kazempour; Walker, Jamie; Sah, Eric; Bennett, Emma; Atrian, Farzaneh; Frost, Bess; Woost, Benjamin; Bennett, Rachel E; Orr, Timothy C; Zhou, Yingyue; Andhey, Prabhakar S; Colonna, Marco; Sudmant, Peter H; Xu, Peng; Wang, Minghui; Zhang, Bin; Zare, Habil; Orr, Miranda E. Profiling senescent cells in human brains reveals neurons with CDKN2D/p19 and tau neuropathology. Nature Aging. 2021;1(12):1107-1116. PubMed |