Anti CDKN2D pAb (ATL-HPA043546)

Atlas Antibodies

SKU: ATL-HPA043546-25

• 

Protein Description: cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Gene Name: CDKN2D
Alternative Gene Name: INK4D, p19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096472: 79%, ENSRNOG00000008956: 45%
Entrez Gene ID: 1032
Uniprot ID: P55273
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDAR
• Gene Sequence: FLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDAR
• Gene ID - Mouse: ENSMUSG00000096472
• Gene ID - Rat: ENSRNOG00000008956
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDKN2D pAb (ATL-HPA043546) – 1 Found

Dehkordi, Shiva Kazempour; Walker, Jamie; Sah, Eric; Bennett, Emma; Atrian, Farzaneh; Frost, Bess; Woost, Benjamin; Bennett, Rachel E; Orr, Timothy C; Zhou, Yingyue; Andhey, Prabhakar S; Colonna, Marco; Sudmant, Peter H; Xu, Peng; Wang, Minghui; Zhang, Bin; Zare, Habil; Orr, Miranda E. Profiling senescent cells in human brains reveals neurons with CDKN2D/p19 and tau neuropathology. Nature Aging. 2021;1(12):1107-1116.