Anti CDKN2C pAb (ATL-HPA019057 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA019057-25
  • Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CDKN2C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY420041).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
Gene Name: CDKN2C
Alternative Gene Name: INK4C, p18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028551: 88%, ENSRNOG00000008956: 88%
Entrez Gene ID: 1031
Uniprot ID: P42773
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG
Gene Sequence LQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG
Gene ID - Mouse ENSMUSG00000028551
Gene ID - Rat ENSRNOG00000008956
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CDKN2C pAb (ATL-HPA019057 w/enhanced validation)
Datasheet Anti CDKN2C pAb (ATL-HPA019057 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDKN2C pAb (ATL-HPA019057 w/enhanced validation)