Anti CDKN2B pAb (ATL-HPA063327)
Atlas Antibodies
- SKU:
- ATL-HPA063327-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CDKN2B
Alternative Gene Name: CDK4I, INK4B, MTS2, P15, p15INK4b, TP15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073802: 59%, ENSRNOG00000006735: 62%
Entrez Gene ID: 1030
Uniprot ID: P42772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAG |
Gene Sequence | MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAG |
Gene ID - Mouse | ENSMUSG00000073802 |
Gene ID - Rat | ENSRNOG00000006735 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDKN2B pAb (ATL-HPA063327) | |
Datasheet | Anti CDKN2B pAb (ATL-HPA063327) Datasheet (External Link) |
Vendor Page | Anti CDKN2B pAb (ATL-HPA063327) at Atlas Antibodies |
Documents & Links for Anti CDKN2B pAb (ATL-HPA063327) | |
Datasheet | Anti CDKN2B pAb (ATL-HPA063327) Datasheet (External Link) |
Vendor Page | Anti CDKN2B pAb (ATL-HPA063327) |