Anti CDKN2B pAb (ATL-HPA063327)

Atlas Antibodies

Catalog No.:
ATL-HPA063327-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
Gene Name: CDKN2B
Alternative Gene Name: CDK4I, INK4B, MTS2, P15, p15INK4b, TP15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073802: 59%, ENSRNOG00000006735: 62%
Entrez Gene ID: 1030
Uniprot ID: P42772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAG
Gene Sequence MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAG
Gene ID - Mouse ENSMUSG00000073802
Gene ID - Rat ENSRNOG00000006735
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDKN2B pAb (ATL-HPA063327)
Datasheet Anti CDKN2B pAb (ATL-HPA063327) Datasheet (External Link)
Vendor Page Anti CDKN2B pAb (ATL-HPA063327) at Atlas Antibodies

Documents & Links for Anti CDKN2B pAb (ATL-HPA063327)
Datasheet Anti CDKN2B pAb (ATL-HPA063327) Datasheet (External Link)
Vendor Page Anti CDKN2B pAb (ATL-HPA063327)