Anti CDKN2B pAb (ATL-HPA063327)

Atlas Antibodies

SKU: ATL-HPA063327-25

• 

Protein Description: cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
Gene Name: CDKN2B
Alternative Gene Name: CDK4I, INK4B, MTS2, P15, p15INK4b, TP15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073802: 59%, ENSRNOG00000006735: 62%
Entrez Gene ID: 1030
Uniprot ID: P42772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAG
• Gene Sequence: MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAG
• Gene ID - Mouse: ENSMUSG00000073802
• Gene ID - Rat: ENSRNOG00000006735
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.