Anti CDKN2AIP pAb (ATL-HPA062142)
Atlas Antibodies
- SKU:
- ATL-HPA062142-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CDKN2AIP
Alternative Gene Name: CARF, FLJ20036
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038069: 90%, ENSRNOG00000022736: 91%
Entrez Gene ID: 55602
Uniprot ID: Q9NXV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEPSKKRVIEGKNSSAVEQDHAK |
Gene Sequence | WANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEPSKKRVIEGKNSSAVEQDHAK |
Gene ID - Mouse | ENSMUSG00000038069 |
Gene ID - Rat | ENSRNOG00000022736 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDKN2AIP pAb (ATL-HPA062142) | |
Datasheet | Anti CDKN2AIP pAb (ATL-HPA062142) Datasheet (External Link) |
Vendor Page | Anti CDKN2AIP pAb (ATL-HPA062142) at Atlas Antibodies |
Documents & Links for Anti CDKN2AIP pAb (ATL-HPA062142) | |
Datasheet | Anti CDKN2AIP pAb (ATL-HPA062142) Datasheet (External Link) |
Vendor Page | Anti CDKN2AIP pAb (ATL-HPA062142) |