Anti CDKN2AIP pAb (ATL-HPA062142)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062142-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CDKN2AIP
Alternative Gene Name: CARF, FLJ20036
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038069: 90%, ENSRNOG00000022736: 91%
Entrez Gene ID: 55602
Uniprot ID: Q9NXV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEPSKKRVIEGKNSSAVEQDHAK |
| Gene Sequence | WANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEPSKKRVIEGKNSSAVEQDHAK |
| Gene ID - Mouse | ENSMUSG00000038069 |
| Gene ID - Rat | ENSRNOG00000022736 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDKN2AIP pAb (ATL-HPA062142) | |
| Datasheet | Anti CDKN2AIP pAb (ATL-HPA062142) Datasheet (External Link) |
| Vendor Page | Anti CDKN2AIP pAb (ATL-HPA062142) at Atlas Antibodies |
| Documents & Links for Anti CDKN2AIP pAb (ATL-HPA062142) | |
| Datasheet | Anti CDKN2AIP pAb (ATL-HPA062142) Datasheet (External Link) |
| Vendor Page | Anti CDKN2AIP pAb (ATL-HPA062142) |