Anti CDKN2AIP pAb (ATL-HPA041397)

Atlas Antibodies

SKU:
ATL-HPA041397-100
  • Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts and leydig.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: CDKN2A interacting protein
Gene Name: CDKN2AIP
Alternative Gene Name: CARF, FLJ20036
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038069: 99%, ENSRNOG00000022736: 99%
Entrez Gene ID: 55602
Uniprot ID: Q9NXV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELRCKSVYLGTGCGKSKENAKAVASREALKLFLKKKVVVKICKRKYRGSEIEDLVLLDEESRPVNLPPAL
Gene Sequence ELRCKSVYLGTGCGKSKENAKAVASREALKLFLKKKVVVKICKRKYRGSEIEDLVLLDEESRPVNLPPAL
Gene ID - Mouse ENSMUSG00000038069
Gene ID - Rat ENSRNOG00000022736
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDKN2AIP pAb (ATL-HPA041397)
Datasheet Anti CDKN2AIP pAb (ATL-HPA041397) Datasheet (External Link)
Vendor Page Anti CDKN2AIP pAb (ATL-HPA041397) at Atlas Antibodies

Documents & Links for Anti CDKN2AIP pAb (ATL-HPA041397)
Datasheet Anti CDKN2AIP pAb (ATL-HPA041397) Datasheet (External Link)
Vendor Page Anti CDKN2AIP pAb (ATL-HPA041397)