Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002924-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CDKN1C
Alternative Gene Name: BWCR, BWS, KIP2, P57
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037664: 76%, ENSRNOG00000059500: 76%
Entrez Gene ID: 1028
Uniprot ID: P49918
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVP |
| Gene Sequence | TMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVP |
| Gene ID - Mouse | ENSMUSG00000037664 |
| Gene ID - Rat | ENSRNOG00000059500 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation) | |
| Datasheet | Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation) | |
| Datasheet | Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation) |
| Citations for Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation) – 1 Found |
| Xing, Yan; Liu, Huiqiang; Cui, Yunpu; Wang, Xinli; Tong, Xiaomei. Abundances of placental imprinted genes CDKN1C, PHLDA2 and IGF-2 are related to low birth weight and early catch-up growth in full-term infants born small for gestational age. Plos One. 14(6):e0218278. PubMed |