Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA002924-25

• 
• 
• 

Protein Description: cyclin-dependent kinase inhibitor 1C (p57, Kip2)
Gene Name: CDKN1C
Alternative Gene Name: BWCR, BWS, KIP2, P57
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037664: 76%, ENSRNOG00000059500: 76%
Entrez Gene ID: 1028
Uniprot ID: P49918
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVP
• Gene Sequence: TMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVP
• Gene ID - Mouse: ENSMUSG00000037664
• Gene ID - Rat: ENSRNOG00000059500
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation) – 1 Found

Xing, Yan; Liu, Huiqiang; Cui, Yunpu; Wang, Xinli; Tong, Xiaomei. Abundances of placental imprinted genes CDKN1C, PHLDA2 and IGF-2 are related to low birth weight and early catch-up growth in full-term infants born small for gestational age. Plos One. 14(6):e0218278.