Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA002924-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cyclin-dependent kinase inhibitor 1C (p57, Kip2)
Gene Name: CDKN1C
Alternative Gene Name: BWCR, BWS, KIP2, P57
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037664: 76%, ENSRNOG00000059500: 76%
Entrez Gene ID: 1028
Uniprot ID: P49918
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVP
Gene Sequence TMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVP
Gene ID - Mouse ENSMUSG00000037664
Gene ID - Rat ENSRNOG00000059500
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation)
Datasheet Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation)
Datasheet Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation)
Citations for Anti CDKN1C pAb (ATL-HPA002924 w/enhanced validation) – 1 Found
Xing, Yan; Liu, Huiqiang; Cui, Yunpu; Wang, Xinli; Tong, Xiaomei. Abundances of placental imprinted genes CDKN1C, PHLDA2 and IGF-2 are related to low birth weight and early catch-up growth in full-term infants born small for gestational age. Plos One. 14(6):e0218278.  PubMed