Anti CDKL4 pAb (ATL-HPA067895)

Atlas Antibodies

Catalog No.:
ATL-HPA067895-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cyclin-dependent kinase-like 4
Gene Name: CDKL4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033966: 84%, ENSRNOG00000040266: 80%
Entrez Gene ID: 344387
Uniprot ID: Q5MAI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FHGISIPEPEDMETLEEKFSDVHPVALNFMKGCLKMNPDDRLTCSQLLESSYFDS
Gene Sequence FHGISIPEPEDMETLEEKFSDVHPVALNFMKGCLKMNPDDRLTCSQLLESSYFDS
Gene ID - Mouse ENSMUSG00000033966
Gene ID - Rat ENSRNOG00000040266
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDKL4 pAb (ATL-HPA067895)
Datasheet Anti CDKL4 pAb (ATL-HPA067895) Datasheet (External Link)
Vendor Page Anti CDKL4 pAb (ATL-HPA067895) at Atlas Antibodies

Documents & Links for Anti CDKL4 pAb (ATL-HPA067895)
Datasheet Anti CDKL4 pAb (ATL-HPA067895) Datasheet (External Link)
Vendor Page Anti CDKL4 pAb (ATL-HPA067895)